DPCstruct | MC33113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 125 |
|---|---|
| Mean domain length (aa) | 227 ± 46 aa |
| Standard deviation of domain lengths | 46.21 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.17 |
| Pfam Score | 82.69 |
| Assigned Pfam label(s) | CL0013- PF03717- CL0051 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1XHQ7 | 141-356 | INIEPLKSERGKILDRNNVELATTGTAHEVGIVPNNVSTSDYKAIAEKLDLSESYIKQQTEQDWVKDDTFVPLKTVQDMNQDLKNFV… |
| A0A812Y776 | 8-250 | LVLVLVLGYVLFRVGRIQSSDGESYRVAAADMWQRDRELPADRGTIFDRDGEELALSIPGYSISVNPKLVTNPDATASMLQGALGLD… |
| T0CMW5 | 66-248 | None |
| A0A1H6L0C0 | 1-357 | None |
| A0A1V8NCH1 | 40-228 | None |
| A0A7W0TW56 | 12-347 | None |
| R5R2J6 | 42-295 | None |
| A0A7T6ZA14 | 160-384 | None |
| A0A4Q5V0Y4 | 33-264 | None |
| V9G378 | 19-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.