DPCstruct | MC33111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 96 ± 11 aa |
| Standard deviation of domain lengths | 10.82 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y4S4P5 | 2-96 | ITQVGVLPVGIEVDGVVHSEFELRPQLVRDSIEALKDERAVGNDSLFGLALLAQQLMKLGSLQKEQITLDLLLDAYDVDMSVLMEAA… |
| A0A812WA44 | 671-764 | QTEYSFVLPRGLVDEDGTVHRDGVMRLATARDEILPLRDPRVRENEAYLSIVLLARVVERIGTVADVHAGVIERLFAADLAFLQDLY… |
| A0A328TNN2 | 1-95 | None |
| A0A2E7CJC2 | 46-153 | None |
| A0A6C7E873 | 1-113 | None |
| A0A1X3DL19 | 24-120 | None |
| A0A397RIA1 | 9-83 | None |
| A0A101UFL9 | 55-144 | None |
| A0A1E3V3D4 | 1-116 | None |
| R0BE22 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.