DPCstruct | MC33106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 163 ± 18 aa |
| Standard deviation of domain lengths | 18.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812TQ23 | 40-200 | IPSLRLQDQRYVRLESRAFSMIHSSLPRSIKEELLATRSLTCLDALFVILKTFQPGGLAERSRLLDALSKPGNGANPRDLVDKLRAW… |
| A0A813H4X6 | 1-166 | MTPCAIVFELMKRYEPGGNKEKQDTLENLGRPTAAATAEEAVKQLRLWEQRLRRLNELKVSIPDPSRLAAALRIITDSVIGKDPDFL… |
| A0A1Q9DHJ6 | 330-470 | None |
| A0A1Q9D7S4 | 123-301 | None |
| A0A1Q9CLF8 | 281-431 | None |
| A0A1Q9C7C7 | 430-614 | None |
| A0A1Q9C764 | 639-792 | None |
| A0A813AGD3 | 173-366 | None |
| A0A812Y857 | 590-761 | None |
| A0A1Q9DY72 | 233-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.