DPCstruct | MC33105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 416 ± 27 aa |
| Standard deviation of domain lengths | 26.72 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812SP99 | 145-563 | SGDAMPNWKDLKLSMKRLVLAWIKTQPGAVLMLTRATMQAGVQLMRPRSYRVLEAWQNDDVRSAFTALRDCFHSPLPALPLTARTNS… |
| A0A812M0W0 | 648-1005 | EPQADVQHAAAEDGEGPDRQQWAEFNRKKKQDVRSWYGTRPGNRLLLLKEMLSVMLGLMRHFLTLGSRRWEEAQLLQVARNEDRDYI… |
| A0A812SZB1 | 655-1039 | None |
| A0A812MUA2 | 305-768 | None |
| A0A1Q9C0T8 | 745-1146 | None |
| A0A1Q9BVX9 | 2-399 | None |
| A0A812NT83 | 3-396 | None |
| A0A812KVW7 | 2-424 | None |
| A0A812ZUM2 | 849-1264 | None |
| A0A812XC78 | 230-675 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.