DPCstruct | MC33100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 164 ± 30 aa |
| Standard deviation of domain lengths | 30.45 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.93 |
| Pfam Score | 78.52 |
| Assigned Pfam label(s) | CL0184- PF00772- CL0021- PF01281- PF03948 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G2EQ94 | 860-1021 | FNFEVVSQKKAKKLRKVILKEDVTDLGKQGQLLDVKAGFFRNFLLPTGKAQLMTPLLLKELKMEDERIEAEKQRVKEEAQQLAMVFQ… |
| A0A674BVH5 | 64-217 | KVVEDTKHAPKEKMELILTQTVAKLGGRGDTVFVKKSVGRNNLLAQGLAVYPSPENKAMFAEELRTVEILKHMELKVEKRTSIEYDI… |
| A0A1E4SL08 | 3-230 | None |
| A0A1D1YQT2 | 5-135 | None |
| J5QBQ7 | 21-161 | None |
| A0A7C7EY95 | 100-248 | None |
| K7FIP8 | 39-197 | None |
| A0A1W0XDW0 | 76-246 | None |
| D3B775 | 26-184 | None |
| A0A453Q4P8 | 1-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.