DPCstruct | MC3310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 122 ± 19 aa |
| Standard deviation of domain lengths | 18.88 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9VB75 | 84-193 | PGLRRLATPTQKEGREIAIEIPSVCEKYIDNIEKEYLLQPAPPLIVDPTVCSMLSKAALKRNLGAHAAVNSSILASGTRKEMAERLK… |
| A0A165NKN6 | 1-137 | MTGLRLFAAGILNQTRKIELEIPEECEHYMNTLHTQYLVHPSAPLITDPHACGFLSANAVKKNLVEHAKYDASIQVKGAKGELILAL… |
| A0A4S4LES1 | 400-522 | None |
| A0A4Y9ZE15 | 411-561 | None |
| A0A0C2XD69 | 230-329 | None |
| A0A5C3Q8B7 | 136-255 | None |
| D8PLH4 | 1-108 | None |
| B0E3B0 | 1-99 | None |
| A0A4S4MSM9 | 350-499 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.