DPCstruct | MC33096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 95 ± 10 aa |
| Standard deviation of domain lengths | 10.18 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 40.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2PLI5 | 64-168 | STSEKIFKSGKSTKELVLRLGQSESEDINVLISNADPNSRFPQLNPFTLQSFIKDKINRHNSIQNMKFTRQGKIIFTTQDPVCAAQL… |
| A0A4Y2B9X6 | 1-105 | MPKAGNCLPLLGSVMGGAVGTRIVYLLCLGKKKFPSSGHQIQQNVTYHKHFDKSFVVKRVSSSNDTFRSVSLFLVEKVISADLRAVS… |
| A0A4Y2ASZ1 | 2-97 | None |
| A0A4Y2PGF5 | 1-93 | None |
| A0A1G4M370 | 1-84 | None |
| A0A4Y2VT59 | 1-99 | None |
| A0A4Y2V5Y5 | 1-97 | None |
| A0A4Y2LM63 | 283-371 | None |
| A0A4Y2TTS3 | 4-85 | None |
| A0A4Y2TRT7 | 3-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.