DPCstruct | MC33095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 175 ± 33 aa |
| Standard deviation of domain lengths | 32.65 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2AXY2 | 11-208 | EWSALHGGGMMYDSNMYSSPLSLLQLPASALPEVTGRLTQPGNSVARFSQDGKSLSDLRSLVPEADFRQASEVTVDVGFVCKKCHMV… |
| A0A1I8ERI5 | 34-180 | YSIRSGLAPIMYDPNLMGTPIPMLQIPESVMAQITTDMSSGRESSKFTQDGKTFQQLVAILPLRDFQCAGSTDSEVGWACPQCTNVF… |
| A0A4U5PCZ8 | 194-351 | None |
| A0A0R3QMS5 | 143-300 | None |
| A0A0K0EFU7 | 1754-1901 | None |
| A0A7E4VWX3 | 1066-1219 | None |
| A0A7R9ATV2 | 75-277 | None |
| A0A834KKC2 | 120-341 | None |
| B7PJQ1 | 7-136 | None |
| U4UQI3 | 1-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.