DPCstruct | MC33094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 125 ± 27 aa |
| Standard deviation of domain lengths | 27.31 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 34.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2APV9 | 14-121 | NFRLDGPLGLRLDFEEEKKRVIAAAIEKVQFEMNEARRISEDQLKNAHLMEMATAVERHKTEISEVKKKQWCYNCEAEAIYHCCWNT… |
| A0A2H1C7A1 | 149-246 | DSSLLKSLEERIHRIYADRLIALTTERDQACEEVSRQSALIAQLKRDHEAEVKRVKQRTWCQVCLNEAFYHCCLGTAYCSKTCQWQH… |
| A0A1I8F8N2 | 55-196 | None |
| A0A5K4EVH0 | 764-914 | None |
| A0A5K4F238 | 1094-1213 | None |
| A0A834UXR1 | 281-402 | None |
| A0A2D4ISH9 | 395-541 | None |
| A0A0K0E905 | 28-175 | None |
| A0A1S3P327 | 2-88 | None |
| A0A7R9LWL5 | 6-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.