DPCstruct | MC33093
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 109 ± 8 aa |
| Standard deviation of domain lengths | 8.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2ANP3 | 1-119 | MGINDTILTNYYREINSEEKLSIHQLLLDFFQLPQQDSKAASDFLKYCSSQMSEAACDEALRKTKSQHKSKLWHEMRYGRITASKAY… |
| A0A1Y1JVZ6 | 2-95 | GVHTLAVNFIVGEGQGVDNFFTFCEERMTPEMCNICFIATKEQSSSVLWHELRYARITASKVYEAARCKTLSGSLVEFIFGAKLKET… |
| A0A835GDV0 | 396-504 | None |
| A0A835L002 | 191-299 | None |
| A0A7J6ZYN5 | 98-214 | None |
| A0A3Q0JIP0 | 41-135 | None |
| A0A6P7FZS3 | 69-182 | None |
| A0A7J7AP59 | 353-461 | None |
| A0A6J2XTG0 | 191-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.