DPCstruct | MC33092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 145 ± 13 aa |
| Standard deviation of domain lengths | 13.16 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 51.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8DW99 | 74-216 | HEAALLAEKLKDDSKFSEAVTVLLSWIERGEVSRRSANQFYSMVQSANSHVRRLMNEKATHEQEMEEAKENFKNALTGILTQFEQIV… |
| A0A6I9XYB4 | 77-204 | HEASLLAEKLKDDSKFSEAIVVLLTWIERGEVNRRTSNQFYSMVQSANSHVRRLMNEKATHEQEMDQAKDNFKNALMGILTQFEQIV… |
| A0A672YEQ6 | 25-189 | None |
| A0A1I8HA16 | 1-147 | None |
| A0A6P8R499 | 321-479 | None |
| A0A4Y2I0L7 | 19-182 | None |
| A0A3B3D296 | 41-183 | None |
| T1J4U0 | 757-888 | None |
| A0A822GIQ0 | 181-309 | None |
| A0A4W5R0B6 | 67-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.