DPCstruct | MC33090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 98 ± 11 aa |
| Standard deviation of domain lengths | 10.62 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 16.00 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0020- CL0354 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V3U165 | 7-94 | ITSSHWSFGVEGRDPYTHVMRLHVNGEISGYQNTNEHRWAKDGDKILFFDAAGEVSSVFARNSDVVDAEHWSGVYNKNSQIRHQISRK |
| I4YML2 | 2-87 | VGNWSVQTSGGSCRVQLSSSPALDLYRASASGCSNQDLSKVNAWDYRDGEVYLYQTGGSVTARLRGSSSSLSGVLAKSGAPLSLTR |
| A0A1I5KDB9 | 113-195 | None |
| A0A837V1E0 | 2-87 | None |
| A0A257VVR7 | 208-293 | None |
| G8PMW9 | 47-147 | None |
| G8PSJ6 | 2-98 | None |
| A0A4Q9VW48 | 168-270 | None |
| A0A1W9I0W4 | 126-227 | None |
| A0A7G5LKD5 | 80-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.