DPCstruct | MC3309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 278 ± 54 aa |
| Standard deviation of domain lengths | 53.69 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 37.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165N9H9 | 17-295 | VAAAPIHRREVPQEHSHEAQLRVVNTFLKKNNPDGIVDAVFALLGNAAAQNGIGNFAGGPDCLQTGVADRAFTNAKAEGDIDGMTNA… |
| A0A842YVP5 | 7-179 | ILAALVAYAAAEVPQEQSHKFILTAATELLQLDNQFEIQDGVFGLLGDAAAAEGAGLVENLDCLHQITADEAFTNALALEDEEEQVN… |
| A0A166BNU8 | 2-300 | None |
| A0A0H2RDL2 | 1-244 | None |
| A0A395IKC6 | 1-300 | None |
| A0A0A1T437 | 1-278 | None |
| C9S5L4 | 1-212 | None |
| A0A5N5QXF8 | 13-286 | None |
| A0A5B0Q5B7 | 9-295 | None |
| A0A0L0SQX6 | 49-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.