DPCstruct | MC33085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 256 ± 73 aa |
| Standard deviation of domain lengths | 72.56 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 92.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540PW89 | 122-364 | LEHADMAYEWNWGANKLGSGSLVDQTVSKELKTAFADYQASLKLKAKGLGTLTVRNLDEYLVKTFLEPSATKYLAALSDSDRTTYLA… |
| A0A139N986 | 57-322 | AYEWMFQVKKIYTFNSRVRPQIINKRQQLLSQSLAAEFPEYVNSLHLGESLTADGRGGDFYQGILNQLSLSLNKFLAKHAQTNDEKE… |
| A0A134C424 | 777-1045 | None |
| A0A7V6MX22 | 126-569 | None |
| A0A3A1YL47 | 494-766 | None |
| E7N1K1 | 92-359 | None |
| A0A660E6I3 | 63-272 | None |
| D9TTI3 | 37-246 | None |
| A0A378MXY3 | 2-173 | None |
| A0A847JXC7 | 3-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.