DPCstruct | MC33084
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 280 ± 34 aa |
| Standard deviation of domain lengths | 34.00 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 26.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11311 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060RI21 | 2-288 | KIGDKAFFSFWENSRAVTSANQAKEVLEKVMAIAQMPLELTGNVSQTRELINQFSDNLAPDHVFWQEFAEVVQFAFPAKSMAADNLL… |
| A0A430AGD8 | 12-287 | YRRYLMCNIKKLSTEQKLFFVEKIGQETRYVGSAIYTEMFKKSRKTAGEKVMLVLSQLGGTIDQQGMLQLIGPYQLDPTLAPHGKFF… |
| A0A346NBN4 | 17-267 | None |
| A0A2S0L667 | 1-198 | None |
| A0A848N2A8 | 209-488 | None |
| G5JV05 | 68-373 | None |
| A0A1G6GNY7 | 22-326 | None |
| A0A1Q8RH01 | 19-340 | None |
| A0A2A7QYW1 | 3-296 | None |
| A0A0R2FJK4 | 61-378 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.