DPCstruct | MC3308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 100 ± 6 aa |
| Standard deviation of domain lengths | 6.10 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165MNP9 | 522-624 | LTLLIEDQRRVVDGEPVSMLVEVRVPLKQADNPEDGYWADAKEVSDELQAGPSRIDGRAKVYTMRGRFRQYFLRITPEDGLECTSAN… |
| A0A165N6U4 | 7-105 | PNDGEPEHLLAEVVIPLRTSATHDGYWANAQELVEQLQLGPSRIDGPAKVFCRRGKYKHCFMRMSDANDVECQPSSLQISPELSIQI… |
| J4HU21 | 628-734 | None |
| K5UVQ0 | 11-96 | None |
| A0A4R0RWK8 | 96-191 | None |
| A0A165F6X0 | 2-107 | None |
| A0A146IA67 | 266-362 | None |
| A0A1B7NBW1 | 303-408 | None |
| E2M4P6 | 1-98 | None |
| A0A2G8SJJ0 | 360-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.