DPCstruct | MC33078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 141 ± 32 aa |
| Standard deviation of domain lengths | 32.05 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 30.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5T917 | 3-146 | GTFIDTIIICTLTGLTLVVTGVWCGMENGAALTNAAFTSAFPVFGGYMLLIGLVLFAFTTILGWNYYGERCMIYLVGTKGVLPYRLV… |
| R6GAY5 | 69-236 | GSAAITAAAATTDNPVRQAYINMTGTFWDTIVVCTITGLAIASSGVLGQIDPATGQLYVGSALTIAAFSTVLGKVGGYLVTIGITLF… |
| R6ZR45 | 1-135 | None |
| A0A378CFB4 | 65-233 | None |
| A0A2E0PF88 | 33-193 | None |
| A0A251WNR5 | 7-146 | None |
| R7CC39 | 3-162 | None |
| A0A5C6X3Y3 | 171-317 | None |
| A0A7Y2YJI7 | 10-146 | None |
| A0A1Q6TVE7 | 2-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.