DPCstruct | MC33077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 270 ± 19 aa |
| Standard deviation of domain lengths | 18.74 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0716 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G3A138 | 4-236 | IPRITRSQIATALANMGTVLPAAVGLSMLFAWWKGHPLLNPAQAHYVVDALHPWRSGTIVYAALTGVLLWLSSLAAGWLENWAVYRR… |
| A0A7C2PLX1 | 2-276 | GFVLIHLLGFTIATKQPAMTASTFAKAIEKGEKSWANQKKLVELIIQVNRSQFAAVLGNVALALLVAFGIASMVIRRGETILSPEET… |
| A0A2P5LAE5 | 374-661 | None |
| A0A841HGK0 | 423-688 | None |
| A0A448MM60 | 43-319 | None |
| A0A0M3CES5 | 109-391 | None |
| A0A0F5K2Q2 | 539-813 | None |
| C0DW91 | 156-438 | None |
| A0A4Q6C7L9 | 23-298 | None |
| A0A7Y3EEW1 | 1-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.