DPCstruct | MC33073
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 268 ± 60 aa |
| Standard deviation of domain lengths | 59.66 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 72.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.39 |
| Pfam Score | 80.53 |
| Assigned Pfam label(s) | PF08164- PF13339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9JTZ9 | 32-283 | SLANTLPQDLDKITKEDKEECAYDTVKDLEQYLIMVVKYQTDLLAKNQNVKMIDKDKATMLTNKLNHKDLEHVLQAHHESFKPYRDE… |
| A0A804N1D4 | 2-225 | MNEHREEDALRGQAVKNQKAIWDKTMEMRFLLQKAFSTSNKLPQESIRTRFCNHDKQIEQAYDDLLNSTKHTLSSMMELQEALLESN… |
| A0A6A7FWF0 | 30-258 | None |
| A0A1Y2HTK8 | 252-535 | None |
| A0A3Q0IXB6 | 20-252 | None |
| A0A4U0W1F8 | 157-513 | None |
| A0A5J5D3C9 | 193-514 | None |
| A0A287QZM9 | 13-261 | None |
| A0A2P6NYC3 | 261-497 | None |
| A0A369RYM0 | 191-537 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.