DPCstruct | MC33072
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 197 ± 19 aa |
| Standard deviation of domain lengths | 18.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 32.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14964 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C4WY30 | 1-182 | MIIKEPPRVVLETVVQWINSDPCLCFTAHYTDLQRALPSGAIPMAATLPFLGLFRWCFFAPLCVKNNNDLELYSELHCALIESVMQG… |
| B4GYM2 | 107-305 | LEQLSMIVPHFAARFMVAVADLYLNEKRSAGLTPPPEALLDVFTEWMTENPTVICQAPPPGVGLPAGATPGPFVNPLASLLRWTVLA… |
| M7AVF8 | 71-296 | None |
| A0A6P7H2U5 | 4-160 | None |
| A0A7J8FIS2 | 350-550 | None |
| A0A674AWG0 | 1-190 | None |
| A0A7J5ZD57 | 168-381 | None |
| V5HGB2 | 1-195 | None |
| A0A3P8WUY3 | 89-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.