DPCstruct | MC33063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 479 ± 94 aa |
| Standard deviation of domain lengths | 93.73 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.40 |
| Pfam Score | 59.12 |
| Assigned Pfam label(s) | CL0661- CL0321- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7PUB4 | 5-531 | ILIRNRMLGTVGNIVDRVDDGDSILTAAQTVGSVSSNSDQMPIENQDSGSFAIEKMGDKAKNLGDQGPEMANEIASSILGATGNTFD… |
| A0A553PZT6 | 54-464 | SNLVKNSVIQQMSQLGTISDTDQFKEDLLSNLSSLIEDSYPLQASDIQSYAQILTRIIEDDSRVNVNSQEFVADILDVLSASLTSID… |
| A0A1I8IF65 | 102-672 | None |
| Q2EG98 | 762-1187 | None |
| A0A158QGB3 | 575-1195 | None |
| A0A6P8KRG2 | 2-438 | None |
| T1H990 | 116-501 | None |
| A0A6J8DWY7 | 18-538 | None |
| A0A820TPP3 | 3-478 | None |
| A0A822BWN1 | 4-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.