DPCstruct | MC33061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 219 ± 16 aa |
| Standard deviation of domain lengths | 15.76 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814LU43 | 13-208 | ELFSTFLTIKIFNFNRFGILNLECFNLNNYYYILNFIPNNKKLVFDQTFKFKVPEQVLSNGIELKFTYIKAFDLNINVFPNQTVNEL… |
| A0A3M7PGQ8 | 1-222 | MITWSKTYWFKTWIDEPLETNNAKNCLEMMKKVEMKNNFGLIDTLEVRSFVSFAQLDFECLESENHYIDEIYMLPDQLLILNKSFRI… |
| A0A814ELP7 | 25-226 | None |
| A0A814BMG2 | 11-233 | None |
| A0A814H2D4 | 1-226 | None |
| A0A813MB82 | 9-245 | None |
| A0A813M3M1 | 1-205 | None |
| A0A813Z245 | 2-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.