DPCstruct | MC3306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 153 ± 26 aa |
| Standard deviation of domain lengths | 26.12 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165MJV9 | 16-157 | MRGIQADVAAWEQDTRDGVYGLDSEEIFWRDLHPFLLERGYRLRPRYTPGWTPSWIGTDINPTYMEDSHAILLPGVMDARREDRSTV… |
| A0A5B1R8J5 | 12-167 | DITSPYFLTPGEKWWRDRQPMLESRGYMLRSRHRPGWTPSWLSKGEHYSYGFEDSIMKTFAVYNIDATRISDGAPVYFKALPPFPDG… |
| A0A4Z0A1F0 | 1-126 | None |
| A0A146I169 | 372-505 | None |
| A0A4Y9ZAI6 | 44-220 | None |
| A0A4Y9ZA95 | 441-591 | None |
| A0A4Y9Z7B4 | 2-133 | None |
| A0A4Y9Y623 | 28-209 | None |
| A0A146IL54 | 720-867 | None |
| A0A0C3BWY2 | 605-750 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.