DPCstruct | MC33059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 212 ± 31 aa |
| Standard deviation of domain lengths | 30.69 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04791 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| P34535 | 24-275 | TWQFAKWTHKYVMQQAEELEADEPEESYFQQMVDKEKEFHNYVRQQIICMWLFMLLYLFAYWLISRLKRKTEREALYAGEEDYFVYR… |
| A0A3M7P6W1 | 5-199 | EEELINILSLLRGPSDNDSSINQTATDLREQQFHNFIREILVCLFIYGFLYLIAFVTIKVLRKAKETDEYVIDYEDAVADRVRIWIC… |
| L8Y929 | 380-554 | None |
| A0A484B230 | 1-192 | None |
| A0A1X7SYW4 | 2-244 | None |
| A0A0N4VW26 | 30-247 | None |
| A0A183AW17 | 11-188 | None |
| A0A6F9B2K2 | 31-253 | None |
| A0A0C2CUN6 | 103-369 | None |
| A0A5F4CSW8 | 148-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.