DPCstruct | MC33054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 808 |
|---|---|
| Mean domain length (aa) | 227 ± 36 aa |
| Standard deviation of domain lengths | 35.77 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.32 |
| Pfam Score | 91.46 |
| Assigned Pfam label(s) | PF13884- PF04917- CL0606- CL0073- PF01391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D5N5T8 | 3-148 | HSANSNHWDFYVNSSGVLTLYYNTVGKGTFDNTTGAYTATSDRRLKKDISVLNSQLDKVRRIPLYQFHYLDNESSAPYSIGVMAQDV… |
| A0A7X9J3S0 | 97-301 | FVGIGTTAPGFPLNFPNALGDKISLYGNTGDHYGFGIQSNLLQIHSSLSTTDIAFGYGQSLSFTENMRIKGNGYLGIGVSSASITHR… |
| A0A2D6E5A1 | 803-1011 | None |
| A0A6M4AVF5 | 228-462 | None |
| A0A2D6G790 | 716-940 | None |
| A0A556N3U5 | 788-1088 | None |
| A0A2G2KAQ0 | 527-735 | None |
| A0A1C6KB66 | 37-292 | None |
| A0A1C6KI10 | 485-717 | None |
| A0A1C6L883 | 240-519 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.