DPCstruct | MC33052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 197 ± 45 aa |
| Standard deviation of domain lengths | 44.66 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 71.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0X758 | 8-180 | PPPPVPQPWVWRCVKCQRDYRIGVTSRCLSCGQRFAYFNKDKNKNKNKDENKPKKLHCETDFAYQDWLRWARWRDMAEVEKTMAQDD… |
| A0A6A6EVU0 | 53-215 | SSSSPPPPSPLQWLWQCHQCQRTYTLGVTRRCLDDGHFFCAGTTTVKTWRKAYKNPKKVRRHKACASEFDYQGWKYWGKWRRSECSD… |
| M1WA75 | 47-255 | None |
| A0A093XU08 | 26-254 | None |
| A0A2T4B2Z6 | 11-204 | None |
| A0A0P7B9H1 | 7-182 | None |
| A0A2T3AXI6 | 3-320 | None |
| A0A6A5VSE2 | 2-158 | None |
| A0A4V6DHV2 | 39-240 | None |
| S3DXE4 | 1-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.