DPCstruct | MC33044
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 134 ± 21 aa |
| Standard deviation of domain lengths | 21.22 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13259 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2XM36 | 8-125 | FDQLLAAENLPPPGPAYYEARRQLWLTPHPQRTAVAPRTNFCRRRKLEKLVVVPEQQKDSDQYCETIRGLWKAICSSKRFNDRVPLR… |
| A0A286UPC6 | 170-306 | PLAADATPFEIVLHQAHKAGTMPGPGLSYFEARRALWSHPPANPPTPADPSPSRVKLEALLSQPGAVESEEVWRAGLKNVWKGLVGG… |
| A0A4R0S093 | 91-241 | None |
| A0A4Q9NTF2 | 18-146 | None |
| J4HYR7 | 7-124 | None |
| A0A4S8MYV9 | 15-137 | None |
| A0A0H2R9D7 | 1-123 | None |
| A0A2H3JZD5 | 1-106 | None |
| A0A0D2PGB8 | 1-105 | None |
| A0A164SA22 | 37-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.