DPCstruct | MC3304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 308 ± 52 aa |
| Standard deviation of domain lengths | 52.20 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18951 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165KRH4 | 44-328 | MGETVIWYLLNDLKKEGLSSNVPALETAMRRRQTAWSTQQFPFGSEMAWDSTGQEGVFVWSKYFNDTKTATNSLNSILAFQPTIPHW… |
| T0JZ65 | 17-265 | YFGFTNTATKSVNSVLGFMQTLPHWGWNGNARRYWDNIYGGKLRRIERQIHHYGSALNALPLLSAFRSSPTDTYLLRTGYAGTTGPL… |
| A0A841TG49 | 265-591 | None |
| A0A3M7DIL5 | 595-932 | None |
| G1XYA5 | 337-722 | None |
| A0A2T3YRF6 | 396-659 | None |
| A0A830HCW7 | 352-623 | None |
| A0A135TUH1 | 400-583 | None |
| A0A7C3RT08 | 655-988 | None |
| A0A7C5FIV5 | 876-1194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.