DPCstruct | MC33038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 144 ± 10 aa |
| Standard deviation of domain lengths | 9.78 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 19.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0WAE7 | 160-315 | WVGVAYAVYYLTREIDDKSAGAISYRIKVNKPLNLPALDEYLALKSIIGEDGIADSDNSLQRVRWTEEDITRWEGYLPTMEMVYDVK… |
| A0A2D7SN02 | 1-154 | MGIFVVWLTRYMGKLEEKTFGAYTGKFTIDKVCRSRKKLNEFVKKRSKSKCGYQWSDANNGKKKLCWEESNNKVFGPGNTCTFIMTL… |
| L1IIY2 | 818-956 | None |
| A0A5A8E8F2 | 698-856 | None |
| A0A7S2RBC2 | 685-829 | None |
| A0A7S3BFQ2 | 1030-1164 | None |
| A0A7R9Y605 | 128-262 | None |
| A0A7S1MYJ3 | 420-549 | None |
| A0A1Y5I9U1 | 670-810 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.