DPCstruct | MC33037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 5.90 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7ZW30 | 2-56 | NGSKTEAIVQKILDPSGVQLNGSRPWDIRIHNPKFYERVLSGGSLALGESYMDGW |
| A0A2D7SMZ3 | 1-70 | MSRANDTVKELLQSADITVNGSEPHDPQVHDERLYHRILQKGSLRLGEAYMDGWWDCEKLDEFFTKLLNA |
| A0A090SLQ5 | 1-63 | None |
| E0ULV5 | 22-92 | None |
| A0A2P6MB31 | 12-66 | None |
| A0A0F2QTD9 | 2-69 | None |
| A0A379AGM5 | 14-86 | None |
| A0A379GHJ2 | 15-87 | None |
| A0A2V8ZTI4 | 11-77 | None |
| A0A7R8WKG5 | 29-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.