DPCstruct | MC33031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 136 ± 13 aa |
| Standard deviation of domain lengths | 12.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| P36943 | 69-197 | EKNVASFAANAGTFLSSQPDSDATRNFITGMATAKANQEIQEWLGKYGTARVKLNVDKDFSLKDSSLEMLYPIYDTPTNMLFTQGAI… |
| A0A198FQ05 | 7-135 | SQAGQLLSSDNAVDASIGYARSIGENLINHDWLNLVGHARFQFGSNKQGDADLLVPLIDNPNSLFFSQLGLRANSERTTSNLGLGYR… |
| I6DN19 | 4-122 | None |
| A0A6N8MWW4 | 1-130 | None |
| A0A379VLT4 | 49-193 | None |
| A0A379W9M1 | 31-157 | None |
| A0A5E6NM82 | 1-133 | None |
| D1KD13 | 11-156 | None |
| A0A248KH80 | 129-267 | None |
| A0A5E6N2Q2 | 104-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.