DPCstruct | MC3303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 306 ± 62 aa |
| Standard deviation of domain lengths | 61.70 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8PID8 | 91-413 | AITPLYRSFRRQIRLLPTVYLREYFKLKTRDDVRAILDTKKADLRARKIKRFEKELRKITLANQGIEKKFEHVLDLAYGRKGKLKWE… |
| A0A165IRL5 | 7-337 | VQLYRSLLCEARRLPHPHLRDYWRLRIQGVFRRNQYLRDEHILQRKVARAQKDLKFLRRANSGYDVLAFERVLDHAYGRRGTMKYEL… |
| A0A137PJB9 | 83-417 | None |
| A0A5N6F874 | 3-212 | None |
| U4LV59 | 22-301 | None |
| A0A364N516 | 50-449 | None |
| A0A1B5L1X2 | 6-330 | None |
| A0A2H1GZU3 | 4-261 | None |
| A0A5C3LVP4 | 33-326 | None |
| R4X9R9 | 4-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.