DPCstruct | MC33027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 149 |
|---|---|
| Mean domain length (aa) | 109 ± 17 aa |
| Standard deviation of domain lengths | 16.74 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 34.29 |
| Pfam Score | 95.53 |
| Assigned Pfam label(s) | PF16639- PF00238- CL0395- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H0V064 | 4-117 | TKTKLNVADNTGAKMVQCIGVPGGTRKRYAHLGQIIRVVVKVAAPRREVKKHQVLKAVIVRQHKPFRRADGSFLIFDDNACCLLNDN… |
| A0A5J9UVE5 | 17-125 | SLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAG… |
| A0A0E0M8I0 | 143-265 | None |
| L0B028 | 176-281 | None |
| A0A835J015 | 29-130 | None |
| A0A814FLV2 | 13-126 | None |
| A0A183MDH2 | 12-124 | None |
| A0A7J6LDK7 | 3-102 | None |
| A0A3M7HNS3 | 1-131 | None |
| A0A6A2YDP7 | 115-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.