DPCstruct | MC33026
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 173 ± 16 aa |
| Standard deviation of domain lengths | 15.95 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 50.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6VH78 | 33-198 | AAPSATATAAAAAVQSRLAAEVLRKLRLATQAEDKDDRDIVCAEVFADVTGELNAAAKDSTGALYRRWYEALAPHFCRSWEASEALL… |
| A0A5J9UFB2 | 1-188 | MRSRSSADRLEALSLEIECKLQKALSSNSQRPQILQQLFADRIEGGRSRSSALSAIQCTKNAILSENDDGVAPVDDREDGWLCFYEI… |
| A0A2R6XX41 | 12-175 | None |
| A0A251UYZ3 | 1-205 | None |
| A0A0E0MRE6 | 1-166 | None |
| A0A1R3HBK1 | 377-555 | None |
| A0A1R3J923 | 566-744 | None |
| A0A7S4PPX5 | 14-183 | None |
| A0A445HLQ0 | 1-183 | None |
| Q9ASR8 | 4-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.