DPCstruct | MC33023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 108 ± 4 aa |
| Standard deviation of domain lengths | 3.89 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5L6A4 | 35-150 | YPSDMLLYYSYTNIQQTNCRSYFNETGRADFSVLSSTLDGRKVDLLNNAKKCLNIEGTQLSRDNVEVLGNMACTLDDNYIRSSDSYI… |
| A0A4W4GB96 | 141-244 | DYGKVQNCTSYFIFLGGADFSIPSSILNRPRILFKNAQTCLGISGFSLNKTRVDILGNMTCTLNSSYIQNSDPLIIEKLKNCGDLTD… |
| A0A6I9MPI5 | 76-185 | None |
| A0A2I0T1Y1 | 5-112 | None |
| A0A3P8YN27 | 544-651 | None |
| A0A6P8TDF3 | 60-167 | None |
| A0A3Q3F268 | 366-471 | None |
| A0A3B4EJ95 | 154-261 | None |
| A0A4W5L688 | 210-312 | None |
| A0A3B3DRP9 | 120-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.