DPCstruct | MC33020
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 130 ± 18 aa |
| Standard deviation of domain lengths | 17.51 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 40.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0001- PF00066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3RLI7 | 2-106 | RLCLNGGTCIDGVNSYRCRCQRGFTGKNCQHQIDLEQFNVTDLLEHELCIKHDCAAKAGNKVCDQVCNYYACHYDSGDCSAGTKPFE… |
| A0A3P6QM34 | 1-126 | MCPHGYRGETCDEAVEICTTNTCQNGGTCIDGTNGYVCHCPFGYTGQRCEIVKEGFVWKSNEIPRDKPSKCRGCLQKAGNGECNEDC… |
| A0A2H2IW79 | 1-143 | None |
| A0A7M5TVE4 | 4-147 | None |
| A0A0R3R2K8 | 18-123 | None |
| A0A0M3KEH1 | 1-136 | None |
| A0A368GH05 | 1-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.