DPCstruct | MC3302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 106 ± 8 aa |
| Standard deviation of domain lengths | 8.34 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F0I6F2 | 11-124 | VVPIPDGTNGYRWIMTSQERAHIAGLLDTDESAIPRGGNVMMRERAVCTSCGKHSGLDDLVHSALDRGIHGRTYMLDILQNGAKENS… |
| A0A165IK42 | 18-120 | PEGVYYWRIDDDQAGRLSRLLDIDFGELGIIGQFVNGVALECAQCGKVSGLDDFVYTAIKTGVHTKDFIVQTLQDRSNARRGNGTLH… |
| A0A194XB96 | 4-108 | None |
| A0A4Q9Q5Q9 | 29-136 | None |
| A0A5C3PLW4 | 1-90 | None |
| A0A3D9RIH3 | 29-122 | None |
| A0A6A6BNH9 | 33-151 | None |
| L2FZL3 | 19-130 | None |
| A0A7G5JQ38 | 1-96 | None |
| G3JNZ3 | 61-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.