DPCstruct | MC33018
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 192 ± 30 aa |
| Standard deviation of domain lengths | 29.91 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08170 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5KYD1 | 5-191 | DGNVVCLPYQSSLCLQDVNRLRNDVLVPGSRLPTPLQGRVPVLLVQQSGKSQGTEMGSWGTGWDLLLPKAWGMAFWVPLVYRGVRIG… |
| A0A0N4YII4 | 525-689 | SKNERLKALSDRLTDSELNALKGKSLGPIKETAAKIPVLVVFRSGGSGRGDTLSGCELIAPCMDFWVALQMRTARASGWRDELTAHL… |
| A0A5N5QQP4 | 412-593 | None |
| A0A816CNH3 | 593-840 | None |
| A0A210PDN7 | 16-186 | None |
| A0A4Y9Y9P2 | 187-378 | None |
| A0A835IY81 | 13-203 | None |
| A0A7I4D5U9 | 228-457 | None |
| A0A4Y7NIK7 | 328-507 | None |
| A0A0R3QAG2 | 42-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.