DPCstruct | MC33017
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 96 ± 9 aa |
| Standard deviation of domain lengths | 8.90 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11819 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F6ZDQ9 | 344-429 | PMKELTHAVRKQQRALEERLEACLEELRRLCLREAELTGTLPVEYPLKPGEKAPRVRRRIGAAYKLDERALHREDPLSSLERELAL |
| A0A4W5KUE8 | 1-97 | MCCGDLLCGSQEGGEQRVDRMTEVQERRCSLQTLLNTRLAELRRVCLQEAELTGEVPGDFPLETGERRPYVRRRVRSYRHGLKAIIR… |
| A0A5N4D0D6 | 215-305 | None |
| K7FHM9 | 15-125 | None |
| A0A0S7F1H7 | 58-144 | None |
| A0A4W5JPQ6 | 185-285 | None |
| A0A2R7W0Y8 | 8-91 | None |
| A0A6I9NLB0 | 174-269 | None |
| A0A0D6LLQ4 | 93-200 | None |
| A0A7J8BBE8 | 58-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.