DPCstruct | MC33013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 6.14 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01529 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5KQE1 | 1-80 | MLMSSSRALQRSCWFQFQLSYSDKDRYEREERPDAQKQILVDIAKKLPIFTRATSGAIRFCDRCQVLKPDRSHHCSVCET |
| A0A7J8E010 | 19-84 | KEFYLSSSEKERYEKEFSQERQQEILRRTARDLPIYTTSASKTIRYCERCQLMKPDRAHHCSACDT |
| A0A183X3D8 | 1-69 | None |
| T1GIE7 | 32-102 | None |
| A0A1I8H256 | 403-473 | None |
| A0A7R8H1C3 | 80-144 | None |
| A0A183W2Z2 | 1-79 | None |
| A0A1J1IEB4 | 94-158 | None |
| A0A817GMR4 | 309-376 | None |
| A0A1I8IW09 | 18-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.