DPCstruct | MC3301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 287 ± 22 aa |
| Standard deviation of domain lengths | 22.33 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 23.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2B7Z0A0 | 162-421 | TIIFHWVAEFTDDLVENMCLGLRRRAAPVNGELLTYAGPRSRLRKQTQCRNGDCCRGQTKASGPNKGWPLSCDEYPFSSAQEGGRGA… |
| A0A165GTD7 | 1-270 | MCIGMRKRGAVQSEELTYLGPKKTHQADKDQNRKDAGCVGADNDCDFRGGLGDSCDEYPFASTHEGGIDQSRCTRAHKRCIPHVQNS… |
| T0LKT4 | 2-273 | None |
| A0A2H3TVD2 | 381-695 | None |
| A0A2H4SL78 | 241-531 | None |
| B6QJM2 | 4-277 | None |
| A0A1V8SHU5 | 72-375 | None |
| A0A0C2JAV5 | 365-654 | None |
| A8N7E2 | 535-797 | None |
| A0A6A6QJ92 | 214-499 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.