DPCstruct | MC33005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 8.99 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U8P546 | 109-197 | QLMRYSILQLLKNLRTHSQGKEITDADILNWANNKVKKAGRTSQMESFKDKSLSSGIFFLELLSAVEPRVVNWGLVTKGETDEDKKL… |
| A0A448YMS4 | 7-86 | VWQLMRRIINNTLAGLAENDSELADAEILNGVDEEVAEGGKSSRIRSFKDSSLATGHFFLDVLLGVKPCYVAYSLVTPGN |
| A0A4C1UQE3 | 52-148 | None |
| A0A6A2XI54 | 374-459 | None |
| A0A6A2Y5F3 | 265-348 | None |
| A0A453PFB1 | 220-306 | None |
| A0A453ESA6 | 2-85 | None |
| A0A287U5V8 | 1-103 | None |
| A0A287U6H1 | 35-127 | None |
| A0A4S4EJ58 | 585-652 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.