DPCstruct | MC33004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 158 ± 12 aa |
| Standard deviation of domain lengths | 11.86 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 60.80 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | CL0023- PF20688 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7JCY3 | 74-233 | MVHTLLERHPHLHSMVIRSYLLIQQYTEAMMALTSSPSLRDHITPETLAMVEDLINAPSREGSQGRGHMLLVRVPSLQLAMLARERL… |
| A0A4W5KFT6 | 3-165 | SVLEERFPKLHSAVIRTQVLIQHYCVALMAVSGRPGSEGRSQHKHTSVETLEIVQSLLSSAQRCPSHHGHMVLLRLPSLALAGWAHQ… |
| A0A0S7JEX9 | 74-233 | None |
| A0A6P5CLZ9 | 886-1043 | None |
| A0A1A6HKK7 | 1-145 | None |
| F1LTR0 | 434-592 | None |
| A0A0S7JFR7 | 563-723 | None |
| A0A0S7JF27 | 74-234 | None |
| B4DDS9 | 264-422 | None |
| A0A2R8QFH6 | 855-1016 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.