DPCstruct | MC3300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 180 ± 21 aa |
| Standard deviation of domain lengths | 20.86 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0276 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A422NB25 | 3-162 | LSTAERGQVEVSALGAVALRGVPRPVEMYQLDAVPGRTFAALRCEKGEEADLDASVGDSNASGFTRNTCYDTSVRFISCLLSPYAPR… |
| A0A3L6L967 | 1-143 | MSLSTEERDQLDATSLGPVALRGVPEPIVMYQLNAVPGRAFAGLRLDRGFYFEDVENFSFSSNSLSFDSLKLSGSAQTISDALHSLL… |
| A0A1G4IK84 | 1-202 | None |
| W6LDE6 | 287-495 | None |
| F9W8J6 | 1-159 | None |
| A0A7G2CRJ1 | 391-551 | None |
| A0A2V2V5A5 | 130-330 | None |
| A0A1G4ID33 | 24-191 | None |
| A0A0A9WRB1 | 58-251 | None |
| A0A640KXU7 | 130-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.