DPCstruct | MC33
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 95 ± 12 aa |
| Standard deviation of domain lengths | 11.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.93 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | PF17196- PF03861 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H0WRE4 | 2-90 | SSARITALEAEVAGLRKALVSRTVIGQATGLIAARKPCTPQQAFQLLVHISQHHNIKLHVAADRLVAAFVHAQLGRTVKVADQMLWD… |
| A0A6G4X0K8 | 7-95 | TGEAERLRQENAQLHRALDSRAVIDQARGMIMALAPCSSGAAWHVLVDVSQHANVKLRDVAHAMVSAGAGQPMPPELQDHLRRAFLR… |
| A0A4Q4Z9A9 | 1-93 | None |
| A0A1Q5KJ73 | 4-93 | None |
| A0A6I4NCJ7 | 5-75 | None |
| A0A852TMG9 | 9-109 | None |
| A0A6I4NGS1 | 50-155 | None |
| A0A429PM36 | 3-86 | None |
| A0A8A7JWJ5 | 26-123 | None |
| A0A559TWR8 | 7-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.