DPCstruct | MC32995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 626 ± 112 aa |
| Standard deviation of domain lengths | 112.37 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 67.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.02 |
| Pfam Score | 84.22 |
| Assigned Pfam label(s) | CL0010- CL0229- PF00439- PF10513 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E9NRF5 | 258-891 | ESQLSDRVEYDMDEQDEQWLMDYNAERKKTEGDEISPEVFEITLTKIEKEWTKLDQQIPKKEDEEGDAEDQRCSICDDGEGTHDNQI… |
| A0A6J3LHL1 | 27-646 | ERSGEELDGEVEYDLDEEDTAWLSTVNERRLASGLSPPLEPDTFELLMDRLEKESYFQQQSNGGGGVAADEDAVCCICMDGECQNSN… |
| A0A4Z2BFT6 | 1-782 | None |
| A0A2J8MEC9 | 202-768 | None |
| S9X1A1 | 135-952 | None |
| I4YCS6 | 3-888 | None |
| A0A7R9PVA9 | 118-665 | None |
| G0N7Y2 | 160-762 | None |
| A0A078B6L3 | 243-759 | None |
| A0A1I7XIU6 | 11-481 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.