DPCstruct | MC32992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 208 ± 22 aa |
| Standard deviation of domain lengths | 21.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9WW52 | 21-200 | LSPSARHEIISTVNNVWDVGIAASLASLAALITPNTTIHRTDIQYDAVQYVTSSQPIFVWVETPFILRRNLHRSPFAIIFSVDCLPP… |
| A0A4Y7TIW6 | 7-226 | FYRMPFGGSTRRTITQRVEDNSDHAHVASKRAHSLIIHLLNAAPPMGFEHFISELANVITPRSAIYRTDSSPRAIDEVSVVPVAFFW… |
| A0A5M3ME54 | 70-281 | None |
| A0A5M3MFC2 | 40-245 | None |
| A0A5M3MH72 | 71-278 | None |
| A0A166ECC8 | 4-172 | None |
| A0A5M3MS12 | 1-217 | None |
| A0A5M3MIR0 | 278-479 | None |
| A0A4Y7TWX6 | 411-644 | None |
| A0A409WT89 | 246-462 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.