DPCstruct | MC32988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 140 ± 30 aa |
| Standard deviation of domain lengths | 29.54 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146I2X7 | 313-440 | FIIWTPARALKRVQLVMDEFDKLKFSETLPLTFGAIPWPVLVDPVRMKVEDISWDAVEAFCRQAKLALLHDQAGYKSLVVSLHRMFH… |
| A0A4Y7TCF5 | 34-188 | ERQRLNEQYQRDMAERRRAQASPSNRMNVDGPPAAPSIDDRLNDYEKRWDILTQKGARDLRFSDMPWPVLCDMRDLSALTPANIEPF… |
| A0A3M7HN66 | 199-399 | None |
| A0A0C3BEJ5 | 102-205 | None |
| A0A0C2ZW22 | 86-225 | None |
| A0A146I2R5 | 502-626 | None |
| A0A4S8MN21 | 3-117 | None |
| K8ELK8 | 238-425 | None |
| A0A061RBU3 | 171-306 | None |
| A0A1J8QBC4 | 638-765 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.