DPCstruct | MC32987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 482 ± 42 aa |
| Standard deviation of domain lengths | 42.05 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 29.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9U7A6 | 2-436 | HLLPKTLHVHDPWNLAIVDWLQSIVEPEEEPFMSWTSKKDLVYSYDLSLPSEAQKAAEEASRAASAAEDEALKIPKVILILPQQTEG… |
| A0A4Y7TAT1 | 52-491 | KTSAHRIEFGQREPFSLIPAPFLQERVPFRLLPKRLIVHDPSRLLRADYSSSDLPNEPKGWDDKPDLVSVYRLELSKEGKAKLKQEE… |
| A0A0D7ADW5 | 393-893 | None |
| A0A284S7S4 | 88-538 | None |
| A0A0C3BP17 | 13-426 | None |
| A0A2A9NCJ0 | 2-428 | None |
| A0A4Q2DJJ9 | 219-738 | None |
| A0A409X1G9 | 170-696 | None |
| A0A409Y2S9 | 267-789 | None |
| A0A067T2A2 | 35-537 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.