DPCstruct | MC32984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 315 ± 20 aa |
| Standard deviation of domain lengths | 19.94 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2DML6 | 37-366 | NSLFDILTLPALSRLEVSGSFVDTLANSMCRQVLGLIQRSKCSLQHFDFAAAIDSTQETLWTILRLSPNLRDLSLRYLRSNELRRFV… |
| A0A4Y7T5W1 | 1-315 | MSGLVRRSGCSLKRLALASSNKPVEYSDFCELLSLCPELESLDIPLPDNGSTIFNSLIVEPFQSVSTPIVPKLRTLGLHYHSGALLQ… |
| A0A0C9WMA5 | 815-1100 | None |
| A0A4S8M3E9 | 68-354 | None |
| A0A4S8LQ02 | 400-687 | None |
| A0A4Q2DF58 | 92-411 | None |
| A0A4Q2DDZ1 | 345-659 | None |
| A0A409XDL2 | 211-532 | None |
| A0A4Y7SHB1 | 222-562 | None |
| A0A409W5U0 | 468-816 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.